PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026635.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 463aa    MW: 52866.3 Da    PI: 7.0902
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026635.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49301552128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++ + 
  Pbr026635.1  30 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSENFRS 126
                  79***************************.89***************888889********************************************* PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  +glkktLvfy+g+apkg +t+W+m+eyrl
  Pbr026635.1 127 IGLKKTLVFYSGKAPKGIRTSWIMNEYRL 155
                  ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5529175IPR003441NAC domain
PROSITE profilePS5100555.58829176IPR003441NAC domain
PfamPF023651.4E-2431155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MSHDDSNKAD HDHEHEHDEY VDEHEHDMVM PGFRFHPTEE ELVEFYLRRK VEGKRFNVEL  60
ITFLDLYRYD PWELPAMAAI GEKEWFFYVP RDRKYRNGDR PNRVTTSGYW KATGADRMIR  120
SENFRSIGLK KTLVFYSGKA PKGIRTSWIM NEYRLPHHET ERYQKGEISL CRVYKRAGVE  180
DHPSLPRCLP ASRASTSRSS VLVAQSTTRS DNKKQHTNNI NTVDSVIEKL QAFNEGQSQQ  240
IHHDHEHQMD QKMNIETEGS SRNSDVTTVL RLSKHKAYPQ GHHQHHNIES STAAALGQPG  300
APTHPVDQEE GMAAFSHHSA NSKQSAANCS SVISSTGNSC AALFTSGSSS VLSSNMNAID  360
DLHRLLNYQP VNVQQQAASN HHQHQQYVNH HLVQYYDHHH HHPQPSNLFS TNFPSAAAAL  420
STIQPQQQQL PSNTLPTAFS DRLWDWNPIS EPTRPDYNNL FK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-553117619165NAC domain-containing protein 19
4dul_A6e-553117619165NAC domain-containing protein 19
1ut7_B6e-553117619165NO APICAL MERISTEM PROTEIN
1ut7_A6e-553117619165NO APICAL MERISTEM PROTEIN
1ut4_B6e-553117619165NO APICAL MERISTEM PROTEIN
1ut4_A6e-553117619165NO APICAL MERISTEM PROTEIN
3swp_D8e-553117622168NAC domain-containing protein 19
3swp_C8e-553117622168NAC domain-containing protein 19
3swp_B8e-553117622168NAC domain-containing protein 19
3swp_A8e-553117622168NAC domain-containing protein 19
3swm_D8e-553117622168NAC domain-containing protein 19
3swm_C8e-553117622168NAC domain-containing protein 19
3swm_B8e-553117622168NAC domain-containing protein 19
3swm_A8e-553117622168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355401.10.0PREDICTED: NAC transcription factor 25 isoform X2
RefseqXP_009355400.10.0PREDICTED: NAC transcription factor 25 isoform X1
TrEMBLA0A0B2P2K81e-152A0A0B2P2K8_GLYSO; Putative NAC domain-containing protein 94
TrEMBLK7MJ701e-152K7MJ70_SOYBN; Uncharacterized protein
STRINGGLYMA17G00650.21e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-113NAC domain containing protein 35